| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries) Uniprot P10824 |
| Domain d1y3ad2: 1y3a D:34-60,D:182-344 [122589] Other proteins in same PDB: d1y3aa1, d1y3ab1, d1y3ac1, d1y3ad1 automatically matched to d1kjya2 complexed with gdp |
PDB Entry: 1y3a (more details), 2.5 Å
SCOPe Domain Sequences for d1y3ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y3ad2 c.37.1.8 (D:34-60,D:182-344) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvii
Timeline for d1y3ad2: