SCOPe 2.07: Domain d1y1db_: 1y1d B:

Lineage for d1y1db_ (1y1d B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
   Uniprot P02766 31-143

8. Domain d1y1db_: 1y1d B: [122540]
   automated match to d1eta1_
   complexed with fhi

Details for d1y1db_

PDB Entry: 1y1d, 1.7 Å

PDB Description: Crystal structure of transthyretin in complex with iododiflunisal

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d1y1db_:

Sequence; same for both SEQRES and ATOM records:

>d1y1db_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d1y1db_:

• d1y1db_ first appeared in SCOP 1.73, called d1y1db1
  
• d1y1db_ appears in SCOPe 2.06
  
• d1y1db_ appears in the current release, SCOPe 2.08