SCOP 1.73: Domain d1y1db1: 1y1d B:1010-1124

Lineage for d1y1db1 (1y1d B:1010-1124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)

8. Domain d1y1db1: 1y1d B:1010-1124 [122540]
   automatically matched to d1bzda_
   complexed with fhi

Details for d1y1db1

PDB Entry: 1y1d, 1.7 Å

PDB Description: Crystal structure of transthyretin in complex with iododiflunisal

PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d1y1db1:

Sequence; same for both SEQRES and ATOM records:

>d1y1db1 b.3.4.1 (B:1010-1124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d1y1db1:

• d1y1db1 is new in SCOP 1.73
  
• d1y1db1 appears in SCOP 1.75
  
• d1y1db1 appears in the current release, SCOPe 2.08, called d1y1db_