Lineage for d1y0pa1 (1y0p A:1-102)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925971Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 925972Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 926080Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 926114Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 926115Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)
  8. 926116Domain d1y0pa1: 1y0p A:1-102 [122507]
    Other proteins in same PDB: d1y0pa2, d1y0pa3
    automatically matched to d1e39a1
    complexed with fad, hem, mez, na

Details for d1y0pa1

PDB Entry: 1y0p (more details), 1.5 Å

PDB Description: Flavocytochrome c3 with mesaconate bound
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1y0pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0pa1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOPe Domain Coordinates for d1y0pa1:

Click to download the PDB-style file with coordinates for d1y0pa1.
(The format of our PDB-style files is described here.)

Timeline for d1y0pa1: