Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries) |
Domain d1y0pa1: 1y0p A:1-102 [122507] Other proteins in same PDB: d1y0pa2, d1y0pa3 automated match to d1qjda1 complexed with fad, hem, mez, na |
PDB Entry: 1y0p (more details), 1.5 Å
SCOPe Domain Sequences for d1y0pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0pa1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]} adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde
Timeline for d1y0pa1: