SCOPe 2.06: Domain d1xxpb1: 1xxp B:186-468

Lineage for d1xxpb1 (1xxp B:186-468)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (19 PDB entries)

8. Domain d1xxpb1: 1xxp B:186-468 [122424]
   automatically matched to d1lyva_

Details for d1xxpb1

PDB Entry: 1xxp, 3 Å

PDB Description: yersinia yoph (residues 163-468) c403s binds phosphotyrosyl peptide at two sites

PDB Compounds: (B:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d1xxpb1:

Sequence; same for both SEQRES and ATOM records:

>d1xxpb1 c.45.1.2 (B:186-468) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d1xxpb1:

• d1xxpb1 first appeared in SCOP 1.73
  
• d1xxpb1 appears in SCOPe 2.05
  
• d1xxpb1 appears in SCOPe 2.07
  
• d1xxpb1 appears in the current release, SCOPe 2.08