![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Uracil PRTase, Upp [53293] (5 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [142555] (5 PDB entries) Uniprot Q980Q4 2-216 |
![]() | Domain d1xtvh_: 1xtv H: [122319] automated match to d1o5oa_ complexed with u5p |
PDB Entry: 1xtv (more details), 2.6 Å
SCOPe Domain Sequences for d1xtvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtvh_ c.61.1.1 (H:) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils kypfiylftvaidpelnnkgyilpglgdagdrafg
Timeline for d1xtvh_: