PDB entry 1xtv

View 1xtv on RCSB PDB site
Description: Sulfolobus solfataricus uracil phosphoribosyltransferase with uridine 5'-monophosphate (UMP) bound to half of the subunits
Class: Transferase
Keywords: Tetramer, type 1 phosphoribosyltransferase, UMP complex
Deposited on 2004-10-24, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtva_
  • Chain 'B':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvb_
  • Chain 'C':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvc_
  • Chain 'D':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvd_
  • Chain 'E':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtve_
  • Chain 'F':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvf_
  • Chain 'G':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvg_
  • Chain 'H':
    Compound: Probable uracil phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtvh_
  • Heterogens: U5P

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtvA (A:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvA (A:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xtvB (B:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvB (B:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xtvC (C:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvC (C:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xtvD (D:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvD (D:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xtvE (E:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvE (E:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xtvF (F:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvF (F:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xtvG (G:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvG (G:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xtvH (H:)
    mplyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgv
    ktkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvy
    iyykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkil
    skypfiylftvaidpelnnkgyilpglgdagdrafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtvH (H:)
    plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
    tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
    yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
    kypfiylftvaidpelnnkgyilpglgdagdrafg