Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein) contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers |
Protein Sso10a (SSO10449) [109678] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries) Uniprot Q5W1E8 |
Domain d1xsxa_: 1xsx A: [122289] automated match to d1r7ja_ |
PDB Entry: 1xsx (more details)
SCOPe Domain Sequences for d1xsxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsxa_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]} akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt kkgeelledirkfnemrknmdqlkekinsvlsirq
Timeline for d1xsxa_: