Lineage for d1xsxa_ (1xsx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983856Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 1983857Protein Sso10a (SSO10449) [109678] (1 species)
  7. 1983858Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries)
    Uniprot Q5W1E8
  8. 1983860Domain d1xsxa_: 1xsx A: [122289]
    automated match to d1r7ja_

Details for d1xsxa_

PDB Entry: 1xsx (more details)

PDB Description: nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil
PDB Compounds: (A:) Sso10a

SCOPe Domain Sequences for d1xsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsxa_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}
akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
kkgeelledirkfnemrknmdqlkekinsvlsirq

SCOPe Domain Coordinates for d1xsxa_:

Click to download the PDB-style file with coordinates for d1xsxa_.
(The format of our PDB-style files is described here.)

Timeline for d1xsxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xsxb_