SCOPe 2.05: Domain d1xsxa_: 1xsx A:

Lineage for d1xsxa_ (1xsx A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein Sso10a (SSO10449) [109678] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries)
   Uniprot Q5W1E8

8. Domain d1xsxa_: 1xsx A: [122289]
   automated match to d1r7ja_

Details for d1xsxa_

PDB Entry: 1xsx

PDB Description: nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil

PDB Compounds: (A:) Sso10a

SCOPe Domain Sequences for d1xsxa_:

Sequence; same for both SEQRES and ATOM records:

>d1xsxa_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}
akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
kkgeelledirkfnemrknmdqlkekinsvlsirq

Timeline for d1xsxa_:

• d1xsxa_ first appeared in SCOP 1.73, called d1xsxa1
  
• d1xsxa_ appears in SCOPe 2.04
  
• d1xsxa_ appears in SCOPe 2.06
  
• d1xsxa_ appears in the current release, SCOPe 2.08