SCOPe 2.01: Domain d1xngb_: 1xng B:

Lineage for d1xngb_ (1xng B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein automated matches [190257] (3 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188123] (2 PDB entries)

8. Domain d1xngb_: 1xng B: [122187]
   Other proteins in same PDB: d1xnga1
   automated match to d1xnga1
   complexed with atp, dnd, mg

Details for d1xngb_

PDB Entry: 1xng, 1.7 Å

PDB Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori

PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1xngb_:

Sequence; same for both SEQRES and ATOM records:

>d1xngb_ c.26.2.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
knafklelpaiakrfnpelehh

Timeline for d1xngb_:

• d1xngb_ first appeared in SCOP 1.73, called d1xngb1
  
• d1xngb_ was called d1xngb1 in SCOP 1.75
  
• d1xngb_ appears in SCOPe 2.02
  
• d1xngb_ appears in the current release, SCOPe 2.08, called d1xngb2