Lineage for d1xngb1 (1xng B:3-257)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693721Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 693722Family c.26.2.1: N-type ATP pyrophosphatases [52403] (7 proteins)
  6. 693802Protein NH3-dependent NAD+-synthetase [52406] (3 species)
  7. 693824Species Helicobacter pylori [TaxId:210] [142084] (2 PDB entries)
  8. 693826Domain d1xngb1: 1xng B:3-257 [122187]
    automatically matched to 1XNG A:3-257
    complexed with atp, dnd, mg

Details for d1xngb1

PDB Entry: 1xng (more details), 1.7 Å

PDB Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOP Domain Sequences for d1xngb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xngb1 c.26.2.1 (B:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}
kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
knafklelpaiakrf

SCOP Domain Coordinates for d1xngb1:

Click to download the PDB-style file with coordinates for d1xngb1.
(The format of our PDB-style files is described here.)

Timeline for d1xngb1: