Lineage for d1xmka1 (1xmk A:294-366)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079707Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1079718Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)
  7. 1079719Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)
  8. 1079720Domain d1xmka1: 1xmk A:294-366 [122165]
    2nd Z-alpha domain
    complexed with cd, cl, ni

Details for d1xmka1

PDB Entry: 1xmk (more details), 0.97 Å

PDB Description: the crystal structure of the zb domain from the rna editing enzyme adar1
PDB Compounds: (A:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d1xmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
ldmaeikekicdylfnvsdssalnlaknigltkardinavlidmerqgdvyrqgttppiw
hltdkkrermqik

SCOPe Domain Coordinates for d1xmka1:

Click to download the PDB-style file with coordinates for d1xmka1.
(The format of our PDB-style files is described here.)

Timeline for d1xmka1: