SCOPe 2.08: Domain d1xmka1: 1xmk A:294-366

Lineage for d1xmka1 (1xmk A:294-366)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)

8. Domain d1xmka1: 1xmk A:294-366 [122165]
   Other proteins in same PDB: d1xmka2
   2nd Z-alpha domain
   complexed with cd, cl, ni

Details for d1xmka1

PDB Entry: 1xmk, 0.97 Å

PDB Description: the crystal structure of the zb domain from the rna editing enzyme adar1

PDB Compounds: (A:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d1xmka1:

Sequence; same for both SEQRES and ATOM records:

>d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
ldmaeikekicdylfnvsdssalnlaknigltkardinavlidmerqgdvyrqgttppiw
hltdkkrermqik

Timeline for d1xmka1:

• d1xmka1 first appeared in SCOP 1.73
  
• d1xmka1 appears in SCOPe 2.07