Lineage for d1xk4c1 (1xk4 C:4-86)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768482Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 768483Protein Calcyclin (S100) [47479] (17 species)
  7. 768563Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (2 PDB entries)
  8. 768564Domain d1xk4c1: 1xk4 C:4-86 [122057]
    automatically matched to d1irja_
    complexed with ca, cl, flc; mutant

Details for d1xk4c1

PDB Entry: 1xk4 (more details), 1.8 Å

PDB Description: Crystal structure of human calprotectin(S100A8/S100A9)
PDB Compounds: (C:) Calgranulin B

SCOP Domain Sequences for d1xk4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarl

SCOP Domain Coordinates for d1xk4c1:

Click to download the PDB-style file with coordinates for d1xk4c1.
(The format of our PDB-style files is described here.)

Timeline for d1xk4c1: