![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (2 PDB entries) |
![]() | Domain d1xk4c1: 1xk4 C:4-86 [122057] automatically matched to d1irja_ complexed with ca, cl, flc |
PDB Entry: 1xk4 (more details), 1.8 Å
SCOPe Domain Sequences for d1xk4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim edldtnadkqlsfeefimlmarl
Timeline for d1xk4c1: