Lineage for d1xk4j1 (1xk4 J:1-87)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768482Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 768483Protein Calcyclin (S100) [47479] (17 species)
  7. 768514Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (2 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 768520Domain d1xk4j1: 1xk4 J:1-87 [122064]
    automatically matched to 1XK4 A:1-87
    complexed with ca, cl, flc; mutant

Details for d1xk4j1

PDB Entry: 1xk4 (more details), 1.8 Å

PDB Description: Crystal structure of human calprotectin(S100A8/S100A9)
PDB Compounds: (J:) Calgranulin A

SCOP Domain Sequences for d1xk4j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk4j1 a.39.1.2 (J:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkksh

SCOP Domain Coordinates for d1xk4j1:

Click to download the PDB-style file with coordinates for d1xk4j1.
(The format of our PDB-style files is described here.)

Timeline for d1xk4j1: