Lineage for d1xfbl_ (1xfb L:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822171Protein automated matches [190095] (20 species)
    not a true protein
  7. 1822314Species Human (Homo sapiens) [TaxId:9606] [254965] (1 PDB entry)
  8. 1822325Domain d1xfbl_: 1xfb L: [121933]
    Other proteins in same PDB: d1xfba1
    automated match to d1ewda_

Details for d1xfbl_

PDB Entry: 1xfb (more details), 3 Å

PDB Description: Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)
PDB Compounds: (L:) Aldolase C

SCOPe Domain Sequences for d1xfbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfbl_ c.1.10.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
gralqasalnawrgqrdnagaateefikraevnglaaqgkye

SCOPe Domain Coordinates for d1xfbl_:

Click to download the PDB-style file with coordinates for d1xfbl_.
(The format of our PDB-style files is described here.)

Timeline for d1xfbl_: