SCOPe 2.07: Domain d1xc8a1: 1xc8 A:132-222

Lineage for d1xc8a1 (1xc8 A:132-222)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
   Uniprot P42371

8. Domain d1xc8a1: 1xc8 A:132-222 [121852]
   Other proteins in same PDB: d1xc8a2, d1xc8a3
   automated match to d1pm5a1
   protein/DNA complex; complexed with gol, zn

Details for d1xc8a1

PDB Entry: 1xc8, 1.95 Å

PDB Description: crystal structure complex between the wild-type lactococcus lactis fpg (mutm) and a fapy-dg containing dna

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1xc8a1:

Sequence; same for both SEQRES and ATOM records:

>d1xc8a1 a.156.1.2 (A:132-222) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssirty

Timeline for d1xc8a1:

• d1xc8a1 first appeared in SCOP 1.73
  
• d1xc8a1 appears in SCOPe 2.06
  
• d1xc8a1 appears in the current release, SCOPe 2.08