Lineage for d1xc8a3 (1xc8 A:223-271)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640696Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2640697Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 2640727Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries)
    Uniprot P42371
  8. 2640729Domain d1xc8a3: 1xc8 A:223-271 [121854]
    Other proteins in same PDB: d1xc8a1, d1xc8a2
    automated match to d1pm5a3
    protein/DNA complex; complexed with gol, zn

Details for d1xc8a3

PDB Entry: 1xc8 (more details), 1.95 Å

PDB Description: crystal structure complex between the wild-type lactococcus lactis fpg (mutm) and a fapy-dg containing dna
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1xc8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc8a3 g.39.1.8 (A:223-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
salgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOPe Domain Coordinates for d1xc8a3:

Click to download the PDB-style file with coordinates for d1xc8a3.
(The format of our PDB-style files is described here.)

Timeline for d1xc8a3: