Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries) Uniprot P42371 |
Domain d1xc8a3: 1xc8 A:223-271 [121854] Other proteins in same PDB: d1xc8a1, d1xc8a2 automated match to d1pm5a3 protein/DNA complex; complexed with gol, zn |
PDB Entry: 1xc8 (more details), 1.95 Å
SCOPe Domain Sequences for d1xc8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xc8a3 g.39.1.8 (A:223-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} salgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk
Timeline for d1xc8a3: