SCOPe 2.06: Domain d1xbzb_: 1xbz B:

Lineage for d1xbzb_ (1xbz B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)

7. Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
   Uniprot P39304

8. Domain d1xbzb_: 1xbz B: [121849]
   automated match to d1kv8b_
   complexed with lx1, mg; mutant

Details for d1xbzb_

PDB Entry: 1xbz, 1.8 Å

PDB Description: crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate

PDB Compounds: (B:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1xbzb_:

Sequence; same for both SEQRES and ATOM records:

>d1xbzb_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtwe
qaqqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplf
kgipihvfiagrsirdaaspveaarqfkrsiaelwg

Timeline for d1xbzb_:

• d1xbzb_ first appeared in SCOP 1.73, called d1xbzb1
  
• d1xbzb_ appears in SCOPe 2.05
  
• d1xbzb_ appears in SCOPe 2.07
  
• d1xbzb_ appears in the current release, SCOPe 2.08