PDB entry 1xbz

View 1xbz on RCSB PDB site
Description: Crystal structure of 3-keto-L-gulonate 6-phosphate decarboxylase E112D/R139V/T169A mutant with bound L-xylulose 5-phosphate
Class: unknown function
Keywords: TIM barrel, UNKNOWN FUNCTION
Deposited on 2004-08-31, released 2005-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xbza_
  • Chain 'B':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xbzb_
  • Heterogens: MG, LX1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbzA (A:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtwe
    qaqqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbzA (A:)
    lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
    akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtweqa
    qqwrdagigqvvyhrsvdaqvawgeaditaikrlsdmgfkvtvagglaledlplfkgipi
    hvfiagrsirdaaspveaarqfkrsiaelw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xbzB (B:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqidltgywtwe
    qaqqwrdagigqvvyhrsvdaqaagvawgeaditaikrlsdmgfkvtvagglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg