SCOPe 2.03: Domain d1x75c_: 1x75 C:

Lineage for d1x75c_ (1x75 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)
   automatically mapped to Pfam PF01845

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)

8. Domain d1x75c_: 1x75 C: [121775]
   Other proteins in same PDB: d1x75a1, d1x75b_
   automated match to d1vuba_

Details for d1x75c_

PDB Entry: 1x75, 2.8 Å

PDB Description: CcdB:GyrA14 complex

PDB Compounds: (C:) Cytotoxic protein ccdB

SCOPe Domain Sequences for d1x75c_:

Sequence, based on SEQRES records:

>d1x75c_ b.34.6.1 (C:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records):

>d1x75c_ b.34.6.1 (C:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytyksryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswr
mmttdmasvpvsvigeevadlshrendiknainlmfwgi

Timeline for d1x75c_:

• d1x75c_ first appeared in SCOP 1.73, called d1x75c1
  
• d1x75c_ appears in SCOPe 2.02
  
• d1x75c_ appears in SCOPe 2.04
  
• d1x75c_ appears in the current release, SCOPe 2.08