Lineage for d1x75c1 (1x75 C:1-101)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665708Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 665709Family b.34.6.1: CcdB [50119] (1 protein)
  6. 665710Protein CcdB [50120] (1 species)
    topoisomerase poison
  7. 665711Species Escherichia coli [TaxId:562] [50121] (5 PDB entries)
  8. 665726Domain d1x75c1: 1x75 C:1-101 [121775]
    automatically matched to d1vuba_

Details for d1x75c1

PDB Entry: 1x75 (more details), 2.8 Å

PDB Description: CcdB:GyrA14 complex
PDB Compounds: (C:) Cytotoxic protein ccdB

SCOP Domain Sequences for d1x75c1:

Sequence, based on SEQRES records: (download)

>d1x75c1 b.34.6.1 (C:1-101) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records): (download)

>d1x75c1 b.34.6.1 (C:1-101) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytyksryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswr
mmttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOP Domain Coordinates for d1x75c1:

Click to download the PDB-style file with coordinates for d1x75c1.
(The format of our PDB-style files is described here.)

Timeline for d1x75c1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x75d1