Lineage for d1x6ha1 (1x6h A:44-80)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1704722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1704815Protein Transcriptional repressor CTCF [144153] (1 species)
  7. 1704816Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries)
    Uniprot P49711 399-434! Uniprot P49711 435-462! Uniprot P49711 515-550! Uniprot P49711 551-587
  8. 1704819Domain d1x6ha1: 1x6h A:44-80 [121743]
    ZnF 11, atypical
    complexed with zn

Details for d1x6ha1

PDB Entry: 1x6h (more details)

PDB Description: solution structures of the c2h2 type zinc finger domain of human transcriptional repressor ctcf
PDB Compounds: (A:) Transcriptional repressor CTCF

SCOPe Domain Sequences for d1x6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}
vpaafvcskcgktftrrntmarhadncagpdgvegen

SCOPe Domain Coordinates for d1x6ha1:

Click to download the PDB-style file with coordinates for d1x6ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x6ha2