SCOPe 2.08: Domain d1x6ha1: 1x6h A:44-80

Lineage for d1x6ha1 (1x6h A:44-80)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Transcriptional repressor CTCF [144153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries)
   Uniprot P49711 399-434! Uniprot P49711 435-462! Uniprot P49711 515-550! Uniprot P49711 551-587

8. Domain d1x6ha1: 1x6h A:44-80 [121743]
   Other proteins in same PDB: d1x6ha3, d1x6ha4
   ZnF 11, atypical
   complexed with zn

Details for d1x6ha1

PDB Entry: 1x6h

PDB Description: solution structures of the c2h2 type zinc finger domain of human transcriptional repressor ctcf

PDB Compounds: (A:) Transcriptional repressor CTCF

SCOPe Domain Sequences for d1x6ha1:

Sequence; same for both SEQRES and ATOM records:

>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}
vpaafvcskcgktftrrntmarhadncagpdgvegen

Timeline for d1x6ha1:

• d1x6ha1 first appeared in SCOP 1.73
  
• d1x6ha1 appears in SCOPe 2.07