Class g: Small proteins [56992] (100 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Protein Transcriptional repressor CTCF [144153] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries) Uniprot P49711 399-434! Uniprot P49711 435-462! Uniprot P49711 515-550! Uniprot P49711 551-587 |
Domain d1x6ha1: 1x6h A:44-80 [121743] Other proteins in same PDB: d1x6ha3, d1x6ha4 ZnF 11, atypical complexed with zn |
PDB Entry: 1x6h (more details)
SCOPe Domain Sequences for d1x6ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} vpaafvcskcgktftrrntmarhadncagpdgvegen
Timeline for d1x6ha1: