| Class g: Small proteins [56992] (91 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc finger protein 462, ZNF462 [144137] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144138] (1 PDB entry) Uniprot Q96JM2 719-793 |
| Domain d1x6fa1: 1x6f A:8-82 [121742] ZnF 6 flanked with unstructured regions complexed with zn |
PDB Entry: 1x6f (more details)
SCOPe Domain Sequences for d1x6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]}
lkrdfiilgngprlqnstyqckhcdsklqstaeltshlnihneefqkrakrqerrkqlls
kqkyadgafadfkqe
Timeline for d1x6fa1: