Lineage for d1x6fa1 (1x6f A:8-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035357Protein Zinc finger protein 462, ZNF462 [144137] (1 species)
  7. 3035358Species Human (Homo sapiens) [TaxId:9606] [144138] (1 PDB entry)
    Uniprot Q96JM2 719-793
  8. 3035359Domain d1x6fa1: 1x6f A:8-82 [121742]
    Other proteins in same PDB: d1x6fa2, d1x6fa3
    ZnF 6 flanked with unstructured regions
    complexed with zn
    has additional insertions and/or extensions that are not grouped together

Details for d1x6fa1

PDB Entry: 1x6f (more details)

PDB Description: solution structures of the c2h2 type zinc finger domain of human zinc finger protein 462
PDB Compounds: (A:) Zinc finger protein 462

SCOPe Domain Sequences for d1x6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]}
lkrdfiilgngprlqnstyqckhcdsklqstaeltshlnihneefqkrakrqerrkqlls
kqkyadgafadfkqe

SCOPe Domain Coordinates for d1x6fa1:

Click to download the PDB-style file with coordinates for d1x6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x6fa1: