SCOPe 2.08: Domain d1x5la1: 1x5l A:8-105

Lineage for d1x5la1 (1x5l A:8-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Ephrin type-A receptor 8 [141039] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141040] (1 PDB entry)
   Uniprot P29322 473-534
   structure of the C-terminal SAM domain is known (101243)

8. Domain d1x5la1: 1x5l A:8-105 [121713]
   Other proteins in same PDB: d1x5la2, d1x5la3

Details for d1x5la1

PDB Entry: 1x5l

PDB Description: solution structure of the second fn3 domain of eph receptor a8 protein

PDB Compounds: (A:) ephrin type-a receptor 8

SCOPe Domain Sequences for d1x5la1:

Sequence; same for both SEQRES and ATOM records:

>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]}
qaapsqvvvirqeragqtsvsllwqepeqpngiileyeikyyekdkemqsystlkavttr
atvsglkpgtryvfqvrartsagcgrfsqamevetgkp

Timeline for d1x5la1:

• d1x5la1 first appeared in SCOP 1.73
  
• d1x5la1 appears in SCOPe 2.07