Lineage for d1x5la1 (1x5l A:8-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 protein domains)
    Pfam PF00041
  6. 657256Protein Ephrin type-A receptor 8 [141039] (1 species)
  7. 657257Species Human (Homo sapiens) [TaxId:9606] [141040] (1 PDB entry)
    structure of the C-terminal SAM domain is known (scop_sp 101243)
  8. 657258Domain d1x5la1: 1x5l A:8-105 [121713]

Details for d1x5la1

PDB Entry: 1x5l (more details)

PDB Description: Solution structure of the second fn3 domain of Eph receptor A8 protein
PDB Compounds: (A:) ephrin type-a receptor 8

SCOP Domain Sequences for d1x5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]}
qaapsqvvvirqeragqtsvsllwqepeqpngiileyeikyyekdkemqsystlkavttr
atvsglkpgtryvfqvrartsagcgrfsqamevetgkp

SCOP Domain Coordinates for d1x5la1:

Click to download the PDB-style file with coordinates for d1x5la1.
(The format of our PDB-style files is described here.)

Timeline for d1x5la1: