SCOPe 2.04: Domain d1x3pa1: 1x3p A:1-54

Lineage for d1x3pa1 (1x3p A:1-54)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein CpSRP43 [141216] (1 species)
   Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
   Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128

8. Domain d1x3pa1: 1x3p A:1-54 [121668]

Details for d1x3pa1

PDB Entry: 1x3p

PDB Description: 3d solution structure of the chromo-3 domain of cpsrp43

PDB Compounds: (A:) cpSRP43

SCOPe Domain Sequences for d1x3pa1:

Sequence; same for both SEQRES and ATOM records:

>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
avaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne

Timeline for d1x3pa1:

• d1x3pa1 first appeared in SCOP 1.73
  
• d1x3pa1 appears in SCOPe 2.03
  
• d1x3pa1 appears in SCOPe 2.05
  
• d1x3pa1 appears in the current release, SCOPe 2.08