Lineage for d1x3pa1 (1x3p A:1-54)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. Protein CpSRP43 [141216] (1 species)
    Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
    Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128
  8. Domain d1x3pa1: 1x3p A:1-54 [121668]

Details for d1x3pa1

PDB Entry: 1x3p (more details)

PDB Description: 3D solution structure of the Chromo-3 domain of cpSRP43
PDB Compounds: (A:) cpSRP43

SCOPe Domain Sequences for d1x3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
avaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne

SCOPe Domain Coordinates for d1x3pa1 are not available.

Timeline for d1x3pa1: