PDB entry 1x3p

View 1x3p on RCSB PDB site
Description: 3D solution structure of the Chromo-3 domain of cpSRP43
Class: unknown function
Keywords: Chromo-2 domain, cpSRP43, chloroplasts, LHCP, protein translocation, unknown function
Deposited on 2005-05-10, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cpSRP43
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x3pa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x3pA (A:)
    avaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne