SCOPe 2.01: Domain d1x27f2: 1x27 F:119-226

Lineage for d1x27f2 (1x27 F:119-226)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein p56-lck tyrosine kinase [55552] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)

8. Domain d1x27f2: 1x27 F:119-226 [121632]
   Other proteins in same PDB: d1x27a1, d1x27b1, d1x27c1, d1x27d1, d1x27e1, d1x27f1
   automatically matched to d1lcka2
   complexed with na

Details for d1x27f2

PDB Entry: 1x27, 2.7 Å

PDB Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas

PDB Compounds: (F:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1x27f2:

Sequence; same for both SEQRES and ATOM records:

>d1x27f2 d.93.1.1 (F:119-226) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
anslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevv
khykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d1x27f2:

• d1x27f2 first appeared in SCOP 1.73
  
• d1x27f2 appears in SCOP 1.75
  
• d1x27f2 appears in SCOPe 2.02
  
• d1x27f2 appears in the current release, SCOPe 2.08