Lineage for d1x1za_ (1x1z A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) Protein automated matches [190130] (11 species)
not a true protein
Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries) 
Domain d1x1za_: 1x1z A: [121613]
automated match to d3li0b_
complexed with bmp, gol
Details for d1x1za_
PDB Entry: 1x1z (more details), 1.45 Å
PDB Description: orotidine 5'-monophosphate decarboxylase (odcase) complexed with bmp (produced from 6-cyanoump)
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylaseSCOPe Domain Sequences for d1x1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1za_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdl
SCOPe Domain Coordinates for d1x1za_:
Click to download the PDB-style file with coordinates for d1x1za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x1za_:
- d1x1za_ first appeared in SCOP 1.73, called d1x1za1
- d1x1za_ appears in SCOPe 2.07
View in 3D
