PDB entry 1x1z

View 1x1z on RCSB PDB site
Description: Orotidine 5'-monophosphate decarboxylase (odcase) complexed with BMP (produced from 6-cyanoump)
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase (odcase), barbituric acid ribosyl 5'-monophosphate (bmp), 6-cyanoump, lyase
Deposited on 2005-04-15, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.162
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (103)
    Domains in SCOPe 2.07: d1x1za_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (103)
    Domains in SCOPe 2.07: d1x1zb_
  • Heterogens: BMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1zA (A:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1zA (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x1zB (B:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1zB (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl