Lineage for d1x0ph_ (1x0p H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953361Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 2953366Protein Hypothetical protein Tll0078 [143369] (1 species)
  7. 2953367Species Thermosynechococcus elongatus [TaxId:146786] [143370] (1 PDB entry)
    Uniprot Q8DMN3 2-143
  8. 2953375Domain d1x0ph_: 1x0p H: [121559]
    automated match to d1x0pa1
    complexed with fad

Details for d1x0ph_

PDB Entry: 1x0p (more details), 2 Å

PDB Description: structure of a cyanobacterial bluf protein, tll0078
PDB Compounds: (H:) hypothetical protein Tll0078

SCOPe Domain Sequences for d1x0ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0ph_ d.58.10.2 (H:) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]}
glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
rsmtaeqcfrflkelydm

SCOPe Domain Coordinates for d1x0ph_:

Click to download the PDB-style file with coordinates for d1x0ph_.
(The format of our PDB-style files is described here.)

Timeline for d1x0ph_: