Lineage for d1x0pg_ (1x0p G:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. Protein Hypothetical protein Tll0078 [143369] (1 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [143370] (1 PDB entry)
    Uniprot Q8DMN3 2-143
  8. Domain d1x0pg_: 1x0p G: [121558]
    automated match to d1x0pa1
    complexed with fad

Details for d1x0pg_

PDB Entry: 1x0p (more details), 2 Å

PDB Description: structure of a cyanobacterial bluf protein, tll0078
PDB Compounds: (G:) hypothetical protein Tll0078

SCOPe Domain Sequences for d1x0pg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0pg_ d.58.10.2 (G:) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]}
glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
rsmtaeqcfrflkelydms

SCOPe Domain Coordinates for d1x0pg_ are not available.

Timeline for d1x0pg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x0pa1, d1x0pb_, d1x0pc_, d1x0pd_, d1x0pe_, d1x0pf_, d1x0ph_, d1x0pi_, d1x0pj_