![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
![]() | Protein Hypothetical protein Tll0078 [143369] (1 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [143370] (1 PDB entry) Uniprot Q8DMN3 2-143 |
![]() | Domain d1x0pj_: 1x0p J: [121561] automated match to d1x0pa1 complexed with fad |
PDB Entry: 1x0p (more details), 2 Å
SCOPe Domain Sequences for d1x0pj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0pj_ d.58.10.2 (J:) Hypothetical protein Tll0078 {Thermosynechococcus elongatus [TaxId: 146786]} glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp rsmtaeqcfrflkelydms
Timeline for d1x0pj_: