Lineage for d1wzaa2 (1wza A:28-436)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093139Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2093169Species Halothermothrix orenii [TaxId:31909] [141767] (1 PDB entry)
    Uniprot Q8GPL8 28-436
  8. 2093170Domain d1wzaa2: 1wza A:28-436 [121490]
    Other proteins in same PDB: d1wzaa1
    complexed with ca

Details for d1wzaa2

PDB Entry: 1wza (more details), 1.6 Å

PDB Description: Crystal structure of alpha-amylase from H.orenii
PDB Compounds: (A:) alpha-amylase A

SCOPe Domain Sequences for d1wzaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]}
fekhgtyyeifvrsfydsdgdgigdlkgiiekldylndgdpetiadlgvngiwlmpifks
psyhgydvtdyykinpdygtledfhklveaahqrgikviidlpinhtserhpwflkasrd
knseyrdyyvwagpdtdtketkldggrvwhysptgmyygyfwsgmpdlnynnpevqekvi
giakywlkqgvdgfrldgamhifppaqydknftwwekfrqeieevkpvylvgevwdiset
vapyfkygfdstfnfklaeaviatakagfpfgfnkkakhiygvydrevgfgnyidapflt
nhdqnrildqlgqdrnkarvaasiyltlpgnpfiyygeeigmrgqgphevirepfqwyng
sgegetywepamyndgftsveqeeknldsllnhyrrlihfrnenpvfyt

SCOPe Domain Coordinates for d1wzaa2:

Click to download the PDB-style file with coordinates for d1wzaa2.
(The format of our PDB-style files is described here.)

Timeline for d1wzaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzaa1