SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wzaa2 (1wza A:28-436)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081613Protein Bacterial alpha-amylase [51447] (10 species)
  7. 2081643Species Halothermothrix orenii [TaxId:31909] [141767] (1 PDB entry)
    Uniprot Q8GPL8 28-436
  8. 2081644Domain d1wzaa2: 1wza A:28-436 [121490]
    Other proteins in same PDB: d1wzaa1
    complexed with ca

Details for d1wzaa2

PDB Entry: 1wza (more details), 1.6 Å

PDB Description: Crystal structure of alpha-amylase from H.orenii
PDB Compounds: (A:) alpha-amylase A

SCOPe Domain Sequences for d1wzaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]}
fekhgtyyeifvrsfydsdgdgigdlkgiiekldylndgdpetiadlgvngiwlmpifks
psyhgydvtdyykinpdygtledfhklveaahqrgikviidlpinhtserhpwflkasrd
knseyrdyyvwagpdtdtketkldggrvwhysptgmyygyfwsgmpdlnynnpevqekvi
giakywlkqgvdgfrldgamhifppaqydknftwwekfrqeieevkpvylvgevwdiset
vapyfkygfdstfnfklaeaviatakagfpfgfnkkakhiygvydrevgfgnyidapflt
nhdqnrildqlgqdrnkarvaasiyltlpgnpfiyygeeigmrgqgphevirepfqwyng
sgegetywepamyndgftsveqeeknldsllnhyrrlihfrnenpvfyt

SCOPe Domain Coordinates for d1wzaa2:

Click to download the PDB-style file with coordinates for d1wzaa2.
(The format of our PDB-style files is described here.)

Timeline for d1wzaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzaa1