Lineage for d1wzaa1 (1wza A:437-515)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804152Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 1804181Species Halothermothrix orenii [TaxId:31909] [141552] (1 PDB entry)
    Uniprot Q8GPL8 437-515
  8. 1804182Domain d1wzaa1: 1wza A:437-515 [121489]
    Other proteins in same PDB: d1wzaa2
    complexed with ca

Details for d1wzaa1

PDB Entry: 1wza (more details), 1.6 Å

PDB Description: Crystal structure of alpha-amylase from H.orenii
PDB Compounds: (A:) alpha-amylase A

SCOPe Domain Sequences for d1wzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]}
gkieiingglnvvafrryndkrdlyvyhnlvnrpvkikvasgnwtllfnsgdkeitpved
nnklmytipayttivleke

SCOPe Domain Coordinates for d1wzaa1:

Click to download the PDB-style file with coordinates for d1wzaa1.
(The format of our PDB-style files is described here.)

Timeline for d1wzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzaa2