SCOPe 2.08: Domain d1wzaa1: 1wza A:437-515

Lineage for d1wzaa1 (1wza A:437-515)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Halothermothrix orenii [TaxId:31909] [141552] (1 PDB entry)
   Uniprot Q8GPL8 437-515

8. Domain d1wzaa1: 1wza A:437-515 [121489]
   Other proteins in same PDB: d1wzaa2
   complexed with ca

Details for d1wzaa1

PDB Entry: 1wza, 1.6 Å

PDB Description: Crystal structure of alpha-amylase from H.orenii

PDB Compounds: (A:) alpha-amylase A

SCOPe Domain Sequences for d1wzaa1:

Sequence; same for both SEQRES and ATOM records:

>d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]}
gkieiingglnvvafrryndkrdlyvyhnlvnrpvkikvasgnwtllfnsgdkeitpved
nnklmytipayttivleke

Timeline for d1wzaa1:

• d1wzaa1 first appeared in SCOP 1.73
  
• d1wzaa1 appears in SCOPe 2.07