| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (9 species) |
| Species Halothermothrix orenii [TaxId:31909] [141552] (1 PDB entry) Uniprot Q8GPL8 437-515 |
| Domain d1wzaa1: 1wza A:437-515 [121489] Other proteins in same PDB: d1wzaa2 complexed with ca |
PDB Entry: 1wza (more details), 1.6 Å
SCOPe Domain Sequences for d1wzaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]}
gkieiingglnvvafrryndkrdlyvyhnlvnrpvkikvasgnwtllfnsgdkeitpved
nnklmytipayttivleke
Timeline for d1wzaa1: