SCOPe 2.07: Domain d1wz3b_: 1wz3 B:

Lineage for d1wz3b_ (1wz3 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.7: APG12-like [142972] (2 proteins)
   Pfam PF04110

6. Protein automated matches [190819] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188103] (1 PDB entry)

8. Domain d1wz3b_: 1wz3 B: [121479]
   Other proteins in same PDB: d1wz3a1
   automated match to d1wz3a1

Details for d1wz3b_

PDB Entry: 1wz3, 1.8 Å

PDB Description: the crystal structure of plant atg12

PDB Compounds: (B:) autophagy 12b

SCOPe Domain Sequences for d1wz3b_:

Sequence; same for both SEQRES and ATOM records:

>d1wz3b_ d.15.1.7 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes
vidlynnfgfdgklvvnyacsmaw

Timeline for d1wz3b_:

• d1wz3b_ first appeared in SCOP 1.73, called d1wz3b1
  
• d1wz3b_ appears in SCOPe 2.06
  
• d1wz3b_ appears in the current release, SCOPe 2.08