Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.7: APG12-like [142972] (2 proteins) Pfam PF04110 |
Protein automated matches [190819] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188103] (1 PDB entry) |
Domain d1wz3b_: 1wz3 B: [121479] Other proteins in same PDB: d1wz3a1 automated match to d1wz3a1 |
PDB Entry: 1wz3 (more details), 1.8 Å
SCOPe Domain Sequences for d1wz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz3b_ d.15.1.7 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes vidlynnfgfdgklvvnyacsmaw
Timeline for d1wz3b_: