Lineage for d1wyee_ (1wye E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181243Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1181244Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1181435Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1181436Protein automated matches [190117] (18 species)
    not a true protein
  7. 1181486Species Sulfolobus tokodaii [TaxId:273063] [186841] (2 PDB entries)
  8. 1181502Domain d1wyee_: 1wye E: [121442]
    automated match to d1v19a_

Details for d1wyee_

PDB Entry: 1wye (more details), 2.8 Å

PDB Description: crystal structure of 2-keto-3-deoxygluconate kinase (form 1) from sulfolobus tokodaii
PDB Compounds: (E:) 2-keto-3-deoxygluconate kinase

SCOPe Domain Sequences for d1wyee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyee_ c.72.1.0 (E:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
ietflremk

SCOPe Domain Coordinates for d1wyee_:

Click to download the PDB-style file with coordinates for d1wyee_.
(The format of our PDB-style files is described here.)

Timeline for d1wyee_: