SCOP 1.73: Domain d1wy8a1: 1wy8 A:8-83

Lineage for d1wy8a1 (1wy8 A:8-83)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like PHD and RING finger domain-containing protein 2 [142944] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142945] (1 PDB entry)

8. Domain d1wy8a1: 1wy8 A:8-83 [121437]

Details for d1wy8a1

PDB Entry: 1wy8

PDB Description: solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)

PDB Compounds: (A:) Np95-like ring finger protein, isoform a

SCOP Domain Sequences for d1wy8a1:

Sequence; same for both SEQRES and ATOM records:

>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}
mwiqvrtidgsktctiedvsrkatieelrervwalfdvrpecqrlfyrgkqlengytlfd
ydvglndiiqllvrpd

Timeline for d1wy8a1:

• d1wy8a1 is new in SCOP 1.73
  
• d1wy8a1 appears in SCOP 1.75
  
• d1wy8a1 appears in the current release, SCOPe 2.08