Lineage for d1wy8a1 (1wy8 A:8-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932390Protein Ubiquitin-like PHD and RING finger domain-containing protein 2 [142944] (1 species)
  7. 2932391Species Human (Homo sapiens) [TaxId:9606] [142945] (1 PDB entry)
    Uniprot Q96PU4 1-76
  8. 2932392Domain d1wy8a1: 1wy8 A:8-83 [121437]
    Other proteins in same PDB: d1wy8a2, d1wy8a3

Details for d1wy8a1

PDB Entry: 1wy8 (more details)

PDB Description: solution structure of the n-terminal ubiquitin-like domain in human np95/icbp90-like ring finger protein (nirf)
PDB Compounds: (A:) Np95-like ring finger protein, isoform a

SCOPe Domain Sequences for d1wy8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}
mwiqvrtidgsktctiedvsrkatieelrervwalfdvrpecqrlfyrgkqlengytlfd
ydvglndiiqllvrpd

SCOPe Domain Coordinates for d1wy8a1:

Click to download the PDB-style file with coordinates for d1wy8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wy8a1: