Lineage for d1wxwc2 (1wxw C:65-382)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705283Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958)
  6. 705291Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)
  7. 705292Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)
  8. 705299Domain d1wxwc2: 1wxw C:65-382 [121415]
    Other proteins in same PDB: d1wxwa1, d1wxwb1, d1wxwc1, d1wxwd1
    automatically matched to 1WXW A:65-382
    complexed with hez

Details for d1wxwc2

PDB Entry: 1wxw (more details), 2.55 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
PDB Compounds: (C:) hypothetical protein TTHA1280

SCOP Domain Sequences for d1wxwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxwc2 c.66.1.51 (C:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

SCOP Domain Coordinates for d1wxwc2:

Click to download the PDB-style file with coordinates for d1wxwc2.
(The format of our PDB-style files is described here.)

Timeline for d1wxwc2: