![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins) C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958) |
![]() | Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries) |
![]() | Domain d1wxwb2: 1wxw B:65-382 [121413] Other proteins in same PDB: d1wxwa1, d1wxwb1, d1wxwc1, d1wxwd1 automatically matched to 1WXW A:65-382 complexed with hez |
PDB Entry: 1wxw (more details), 2.55 Å
SCOP Domain Sequences for d1wxwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxwb2 c.66.1.51 (B:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv llnhpethylkfavfqvl
Timeline for d1wxwb2: